OAZ3 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Ornithine decarboxylase catalyzes the conversion of ornithine to putrescine in the first and apparently rate-limiting step in polyamine biosynthesis. The ornithine decarboxylase antizymes play a role in the regulation of polyamine synthesis by binding to and inhibiting ornithine decarboxylase. Antizyme expression is auto-regulated by polyamine-enhanced translational frameshifting. In contrast to antizymes 1 and 2, which are widely expressed throughout the body, the expression of this gene product (antizyme 3) is restricted to testis germ cells, and thus it is a possible candidate for heritable forms of human male infertility. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OAZ3

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: DRRLFLDIPYQALDQGNRESLTATLEYVEEKTNVDSVFVNFQNDRNDRGA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ornithine decarboxylase antizyme 3

Protein Size: 187

Purification: Affinity Purified

• Artikelnummer: AVIARP53713_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53713_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51686
• Wirt: Rabbit
• Konjugat: Conjugated, HRP