OBP2A Antibody - middle region : FITC

OBP2A Antibody - middle region : FITC
Artikelnummer
AVIARP55086_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a small extracellular protein belonging to the lipocalin superfamily. The protein is thought to transport small, hydrophobic, volatile molecules or odorants through the nasal mucus to olfactory receptors, and may also function as a scavenger of highly concentrated or toxic odors. The protein is expressed as a monomer in the nasal mucus, and can bind diverse types of odorants with a higher affinity for aldehydes and fatty acids. This gene and a highly similar family member are located in a cluster of lipocalin genes on chromosome 9. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human OBP2A

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: QKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Odorant-binding protein 2a

Protein Size: 228

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55086_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55086_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29991
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×