Odf1 Antibody - middle region : Biotin

Odf1 Antibody - middle region : Biotin
Artikelnummer
AVIARP53765_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Odf1 is a component of the outer dense fibers (ODF) of spermatozoa. ODF are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elastic structures and elastic recoil of the sperm tail.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: VCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Outer dense fiber protein 1

Protein Size: 247

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53765_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53765_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 18285
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×