Odf1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Odf1 is a component of the outer dense fibers (ODF) of spermatozoa. ODF are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elastic structures and elastic recoil of the sperm tail.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: VCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Outer dense fiber protein 1

Protein Size: 247

Purification: Affinity Purified

• Artikelnummer: AVIARP53765_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53765_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 18285
• Wirt: Rabbit
• Konjugat: Conjugated, HRP