ODF2 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The outer dense fibers are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail from shear forces during epididymal transport and ejaculation. Defects in the outer dense fibers lead to abnormal sperm morphology and infertility. ODF2 is one of the major outer dense fiber proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ODF2

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVTKSHKRGMKG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cDNA FLJ56030, highly similar to Homo sapiens outer dense fiber of sperm tails 2 (ODF2), transcript variant 2, mRNA EMBL BAG63297.1

Protein Size: 638

Purification: Affinity Purified

• Artikelnummer: AVIARP53831_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53831_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4957
• Wirt: Rabbit
• Konjugat: Conjugated, HRP