OGDHL Antibody - N-terminal region : FITC

OGDHL Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57175_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of OGDHL remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OGDHL

Molecular Weight: 114kDa

Peptide Sequence: Synthetic peptide located within the following region: VFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWLENPQSVHKSWDSFFR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 2-oxoglutarate dehydrogenase-like, mitochondrial

Protein Size: 1010

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57175_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57175_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55753
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×