OLAH Antibody - N-terminal region : Biotin

OLAH Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56263_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: OLAH plays a role in fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex. The chain length of the released f

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OLAH

Key Reference: Nakamura,N., (2006) DNA Res. 13 (4), 169-183

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: S-acyl fatty acid synthase thioesterase, medium chain

Protein Size: 265

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56263_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56263_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Pig (Porcine), Rabbit, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55301
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×