OLAH Antibody - N-terminal region : HRP

OLAH Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56264_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: OLAH plays a role in fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex. The chain length of the released f

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OLAH

Key Reference: Nakamura,N., (2006) DNA Res. 13 (4), 169-183

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: S-acyl fatty acid synthase thioesterase, medium chain

Protein Size: 265

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56264_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56264_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55301
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×