OMD Antibody - middle region : Biotin

OMD Antibody - middle region : Biotin
Artikelnummer
AVIARP56612_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: OMD may be implicated in biomineralization processes. Has a function in binding of osteoblasts via the alpha(V)beta(3)-integrin.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OMD

Key Reference: Couble,M.L., (2004) Histochem. Cell Biol. 121 (1), 47-53

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: LLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Osteomodulin

Protein Size: 421

Purification: Affinity Purified

Subunit: 5
Mehr Informationen
Artikelnummer AVIARP56612_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56612_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 56612
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×