OMD Antibody - middle region : HRP

OMD Antibody - middle region : HRP
Artikelnummer
AVIARP56612_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: OMD may be implicated in biomineralization processes. Has a function in binding of osteoblasts via the alpha(V)beta(3)-integrin.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OMD

Key Reference: Couble,M.L., (2004) Histochem. Cell Biol. 121 (1), 47-53

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: LLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Osteomodulin

Protein Size: 421

Purification: Affinity Purified

Subunit: 5
Mehr Informationen
Artikelnummer AVIARP56612_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56612_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 56612
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×