Omp Antibody - C-terminal region : HRP

Omp Antibody - C-terminal region : HRP
Artikelnummer
AVIARP56669_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Omp may act as a modulator of the olfactory signal-transduction cascade.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: EDSDAMDWNEADALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Olfactory marker protein

Protein Size: 163

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56669_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56669_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 18378
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×