OMP Antibody - middle region : Biotin

OMP Antibody - middle region : Biotin
Artikelnummer
AVIARP56668_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Olfactory marker protein is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human. Results of the mouse kno

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OMP

Key Reference: Behrens,M., (2003) J. Neurochem. 86 (5), 1289-1296

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: WRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Olfactory marker protein

Protein Size: 163

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56668_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56668_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Goat (Caprine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4975
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×