OPA1 Antibody - N-terminal region : Biotin

OPA1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57715_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene product is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. It is a component of the mitochondrial network. Mutations in this gene have been associated with optic atrophy type 1, which is a dominantly inherited optic neuropathy resulting in progressive loss of visual acuity, leading in many cases to legal blindness. Multiple transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 102kDa

Peptide Sequence: Synthetic peptide located within the following region: SPEETAFRATDRGSESDKHFRKVSDKEKIDQLQEELLHTQLKYQRILERL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitochondrial dynamin-like 120 kDa protein EMBL ADP90061.1

Protein Size: 924

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57715_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57715_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4976
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×