ORC4L Antibody - middle region : Biotin

ORC4L Antibody - middle region : Biotin
Artikelnummer
AVIARP57782_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ORC4L

Key Reference: Clarke,C.A. Biochem. J. 388 (PT 2), 705-712 (2005)

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: VLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Origin recognition complex subunit 4

Protein Size: 436

Purification: Affinity Purified

Subunit: 4
Mehr Informationen
Artikelnummer AVIARP57782_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57782_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5000
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×