OSGIN1 Antibody - N-terminal region : FITC

OSGIN1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55853_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: OSGIN1 regulates the differentiation and proliferation of normal cells through the regulation of cell death.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OSGIN1

Key Reference: Ong,C.K., (2007) Oncogene 26 (8), 1155-1165

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: APGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Oxidative stress-induced growth inhibitor 1

Protein Size: 560

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55853_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55853_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29948
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×