OTUB1 Antibody - middle region : FITC

OTUB1 Antibody - middle region : FITC
Artikelnummer
AVIARP57000_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OTUB1

Key Reference: Juris,S.J., (2006) FEBS Lett. 580 (1), 179-183

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: KIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin thioesterase OTUB1

Protein Size: 271

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57000_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57000_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55611
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×