OTUD6B Antibody - middle region : HRP

OTUD6B Antibody - middle region : HRP
Artikelnummer
AVIARP56809_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Deubiquitinating enzymes (DUBs; see MIM 603478) are proteases that specifically cleave ubiquitin (MIM 191339) linkages, negating the action of ubiquitin ligases. DUBA5 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OTUD6B

Key Reference: Worby,C.A. (2002) Nat. Rev. Mol. Cell Biol. 3 (12), 919-931

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: EIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: OTU domain-containing protein 6B

Protein Size: 323

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56809_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56809_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51633
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×