PADI4 Antibody - middle region : Biotin

PADI4 Antibody - middle region : Biotin
Artikelnummer
AVIARP54888_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PADI4 is an enzyme responsible for the conversion of arginine residues to citrulline residues. This protein may play a role in granulocyte and macrophage development leading to inflammation and immune response.This gene is a member of a gene family which encodes enzymes responsible for the conversion of arginine residues to citrulline residues. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PADI4

Key Reference: Costenbader,K.H., (er) Arthritis Res. Ther. 10 (3), R52 (2008) In press

Molecular Weight: 74kDa

Peptide Sequence: Synthetic peptide located within the following region: TGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQAL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein-arginine deiminase type-4

Protein Size: 663

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54888_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54888_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23569
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×