PAFAH1B1 Antibody - N-terminal region : FITC

PAFAH1B1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56108_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This locus was identified as encoding a gene that when mutated or lost caused the lissencephaly associated with Miller-Dieker lissencephaly syndrome. PAFAH1B1 is the non-catalytic alpha subunit of the intracellular Ib isoform of platelet-activating factor acteylhydrolase, a heterotrimeric enzyme that specifically catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist: one composed of multiple subunits, the other, a single subunit. In addition, a single-subunit isoform of this enzyme is found in serum.PAFAH1B1 was identified as encoding a gene that when mutated or lost caused the lissencephaly associated with Miller-Dieker lissencephaly syndrome. PAFAH1B1 encodes the non-catalytic alpha subunit of the intracellular Ib isoform of platelet-activating factor acteylhydrolase, a heterotrimeric enzyme that specifically catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist: one composed of multiple subunits, the other, a single subunit. In addition, a single-subunit isoform of this enzyme is found in serum. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-378 AC015799.23 48129-48506 c 379-600 AC015799.23 3815-4036 c 601-685 AC005696.1 40697-40781 686-760 AC005696.1 41341-41415 761-967 AC005696.1 42317-42523 968-1136 AC005696.1 45488-45656 1137-1239 AC005696.1 47980-48082 1240-1468 AC005696.1 49385-49613 1469-1570 AC005696.1 51830-51931 1571-1727 AC005696.1 55489-55645 1728-5614 AC005696.1 57054-60940

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PAFAH1B1

Key Reference: Campo,S., (2008) Aging Clin Exp Res 20 (2), 171-177

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: KLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Platelet-activating factor acetylhydrolase IB subunit alpha

Protein Size: 410

Purification: Affinity Purified

Subunit: alpha
Mehr Informationen
Artikelnummer AVIARP56108_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56108_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 5048
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×