PAIP2 Antibody - N-terminal region : FITC

PAIP2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56241_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PAIP2 acts as a repressor in the regulation of translation initiation of poly(A)-containing mRNAs. Its inhibitory activity on translation is mediated via its action on PABPC1. It displaces the interaction of PABPC1 with poly(A) RNA and competes with PAIP1 for binding to PABPC1. Its association with PABPC1 results in disruption of the cytoplasmic poly(A) RNP structure organization.

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: MKDPSRSSTSPSIINEDVIINGHSHEDDNPFAEYMWMENEEEFNRQIEEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Polyadenylate-binding protein-interacting protein 2

Protein Size: 127

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56241_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56241_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51247
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×