PALM Antibody - N-terminal region : FITC

PALM Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56270_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the paralemmin protein family. The product of this gene is a prenylated and palmitoylated phosphoprotein that associates with the cytoplasmic face of plasma membranes and is implicated in plasma membrane dynamics in neurons and other cell types. Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PALM

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: LEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Paralemmin-1

Protein Size: 343

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56270_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56270_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5064
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×