PAOX Antibody - C-terminal region : FITC

PAOX Antibody - C-terminal region : FITC
Artikelnummer
AVIARP53830_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PAOX belongs to the flavin monoamine oxidase family. PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion. It can also oxidize N(1)-acetylspermidine to putrescine. PAOX does not oxidize spermidine. It plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PAOX

Key Reference: Jarvinen,A., (2006) J. Biol. Chem. 281 (8), 4589-4595

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: VGSTGGDLDLLAQPLPADGAGAQLQILFAGEATHRTFYSTTHGALLSGWRE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peroxisomal N(1)-acetyl-spermine/spermidine oxidase

Protein Size: 511

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53830_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53830_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 196743
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×