Paox Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Paox

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: FQLAAEFGLLGEKELSEENQLVETGGHVALPSVSCTSSGTSVSLELVTEM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: RCG47968, isoform CRA_a EMBL EDM11900.1

Protein Size: 531

Purification: Affinity Purified

• Artikelnummer: AVIARP53828_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53828_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 293589
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin