PAOX Antibody - middle region : FITC

PAOX Antibody - middle region : FITC
Artikelnummer
AVIARP53848_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PAOX belongs to the flavin monoamine oxidase family. PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion. It can also oxidize N(1)-acetylspermidine to putrescine. PAOX does not oxidize spermidine. It plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PAOX

Key Reference: Jarvinen,A., (2006) J. Biol. Chem. 281 (8), 4589-4595

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: RGSAVGMEGGRPPPQSVGPAGAAAQAQALAGPSLLCSTRVGGRLGPSFLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peroxisomal N(1)-acetyl-spermine/spermidine oxidase

Protein Size: 486

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53848_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53848_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 196743
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×