PARVG Antibody - C-terminal region : Biotin

PARVG Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP57610_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Members of the parvin family, including PARVG, are actin-binding proteins associated with focal contacts.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PARVG

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: LLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALELLKDEGLLSCPVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Gamma-parvin

Protein Size: 331

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57610_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57610_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64098
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×