PAX1 Antibody - middle region : Biotin

PAX1 Antibody - middle region : Biotin
Artikelnummer
AVIARP58040_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The PAX genes, including PAX1, are a highly conserved family of developmental control genes that encode transcription factors and have been shown to play a role in pattern formation during embryogenesis in vertebrates.The PAX genes, including PAX1, are a highly conserved family of developmental control genes that encode transcription factors and have been shown to play a role in pattern formation during embryogenesis in vertebrates (McGaughran et al., 2003 [PubMed 12774041]). See PAX7 (MIM 167410) for a discussion of paired box domain genes.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PAX1

Key Reference: Vatanavicharn,N., (2007) Am. J. Med. Genet. A 143 (19), 2292-2302

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: SISRILRNKIGSLAQPGPYEASKQPPSQPTLPYNHIYQYPYPSPVSPTGA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Paired box protein Pax-1

Protein Size: 440

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58040_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58040_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5075
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×