PCCB Antibody - middle region : HRP

PCCB Antibody - middle region : HRP
Artikelnummer
AVIARP56116_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PCCB is a subunit of the propionyl-CoA carboxylase (PCC) enzyme, which is involved in the catabolism of propionyl-CoA. PCC is a mitochondrial enzyme that probably acts as a dodecamer of six alpha subunits and six beta subunits. Defects in this gene are a cause of propionic acidemia type II (PA-2).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCCB

Key Reference: Desviat,L.R., (2006) J. Hum. Genet. 51 (11), 992-997

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: PGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Propionyl-CoA carboxylase beta chain, mitochondrial

Protein Size: 539

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56116_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56116_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5096
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×