PCDH17 Antibody - C-terminal region : Biotin

PCDH17 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP54517_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PCDH17 contains six extracellular cadherin domains, a transmembrane domain, and a cytoplasmic tail differing from those of the classical cadherins.It may play a role in the establishment and function of specific cell-cell connections in the brain.This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The encoded protein contains six extracellular cadherin domains, a transmembrane domain, and a cytoplasmic tail differing from those of the classical cadherins. The encoded protein may play a role in the establishment and function of specific cell-cell connections in the brain. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-866 AL445288.9 90051-90916 867-4389 BC028165.1 1-3523 4390-8009 AL445216.6 89335-92954

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PCDH17

Key Reference: Szafranski,K., Genome Biol. 8 (8), R154 (2007)

Molecular Weight: 124kDa

Peptide Sequence: Synthetic peptide located within the following region: SEMGAVLEQLDHPNRDLGRESVDAEEVVREIDKLLQDCRGNDPVAVRK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protocadherin-17

Protein Size: 1159

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54517_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54517_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27253
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×