PCNP Antibody - middle region : FITC

PCNP Antibody - middle region : FITC
Artikelnummer
AVIARP57393_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PCNP may be involved in cell cycle regulation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCNP

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: AKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: PEST proteolytic signal-containing nuclear protein

Protein Size: 178

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57393_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57393_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57092
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×