PCOLCE Antibody - middle region : HRP

PCOLCE Antibody - middle region : HRP
Artikelnummer
AVIARP56378_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PCOLCE binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCOLCE

Key Reference: Grgurevic,L., (2007) Int Orthop 31 (6), 743-751

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Procollagen C-endopeptidase enhancer 1

Protein Size: 449

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56378_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56378_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5118
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×