Pcyt2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: FCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ethanolamine-phosphate cytidylyltransferase

Protein Size: 404

Purification: Affinity Purified

• Artikelnummer: AVIARP53606_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53606_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 68671
• Wirt: Rabbit
• Konjugat: Conjugated, FITC