PDE1A Antibody - C-terminal region : FITC

PDE1A Antibody - C-terminal region : FITC
Artikelnummer
AVIARP53625_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PDE1A belongs to the cyclic nucleotide phosphodiesterase family. It has a higher affinity for cGMP than for cAMP. The exact function of PDE1A remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PDE1A

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: AVDLKSFKNNLVDIIQQNKERWKELAAQGESDLHKNSEDLVNAEEKHDET

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A

Protein Size: 545

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53625_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53625_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5136
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×