Pde2a Antibody - N-terminal region : FITC

Pde2a Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56379_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The activation of Pde2a induces decreased cAMP accumulation; It is involved in nitric oxide mediated signaling in cardiac fibroblasts.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 104kDa

Peptide Sequence: Synthetic peptide located within the following region: CRSQQYPAARPAEPRGQQVFLKPDEPPPQPCADSLQDALLSLGAVIDIAG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cGMP-dependent 3',5'-cyclic phosphodiesterase

Protein Size: 935

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56379_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56379_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 81743
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×