Pde2a Antibody - N-terminal region : HRP

Pde2a Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56379_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The activation of Pde2a induces decreased cAMP accumulation; It is involved in nitric oxide mediated signaling in cardiac fibroblasts.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 104kDa

Peptide Sequence: Synthetic peptide located within the following region: CRSQQYPAARPAEPRGQQVFLKPDEPPPQPCADSLQDALLSLGAVIDIAG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cGMP-dependent 3',5'-cyclic phosphodiesterase

Protein Size: 935

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56379_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56379_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 81743
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×