PDE4D Antibody - C-terminal region : FITC

PDE4D Antibody - C-terminal region : FITC
Artikelnummer
AVIARP56673_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes one of four mammalian counterparts to the fruit fly 'dunce' gene. The encoded protein has 3',5'-cyclic-AMP phosphodiesterase activity and degrades cAMP, which acts as a signal transduction molecule in multiple cell types. This gene uses different promoters to generate multiple alternatively spliced transcript variants that encode functional proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PDE4D

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: FQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cAMP-specific 3',5'-cyclic phosphodiesterase 4D

Protein Size: 507

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56673_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56673_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5144
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×