Pde4d Antibody - N-terminal region : FITC

Pde4d Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56672_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Pde4d hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 84kDa

Peptide Sequence: Synthetic peptide located within the following region: PFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITEEAYQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cAMP-specific 3',5'-cyclic phosphodiesterase 4D

Protein Size: 747

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56672_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56672_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 238871
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×