PDE7B Antibody - middle region : FITC

PDE7B Antibody - middle region : FITC
Artikelnummer
AVIARP55364_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The 3',5'-cyclic nucleotides cAMP and cGMP function as second messengers in a wide variety of signal transduction pathways. 3',5'-cyclic nucleotide phosphodiesterases (PDEs) catalyze the hydrolysis of cAMP and cGMP to the corresponding 5'-monophosphates a

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDE7B

Key Reference: Gardner,C., (2000) Biochem. Biophys. Res. Commun. 272 (1), 186-192

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: IGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cAMP-specific 3',5'-cyclic phosphodiesterase 7B

Protein Size: 450

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55364_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55364_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27115
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×