PDHA2 Antibody - N-terminal region : FITC

PDHA2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP53632_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2. It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDHA2

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial

Protein Size: 388

Purification: Affinity Purified

Subunit: alpha, testis-specific form, mitochondrial
Mehr Informationen
Artikelnummer AVIARP53632_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53632_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5161
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×