PDHA2 Antibody - N-terminal region : HRP

PDHA2 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP53632_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2. It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDHA2

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial

Protein Size: 388

Purification: Affinity Purified

Subunit: alpha, testis-specific form, mitochondrial
Mehr Informationen
Artikelnummer AVIARP53632_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53632_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5161
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×