PDS5B Antibody - middle region : FITC

PDS5B Antibody - middle region : FITC
Artikelnummer
AVIARP58313_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PDS5B plays a role in androgen-induced proliferative arrest in prostate cells. It is required for maintenance of sister chromatid cohesion during mitosis. Defects in PDS5B may be the cause of some cancers including esophageal cancer.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDS5B

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 159kDa

Peptide Sequence: Synthetic peptide located within the following region: DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sister chromatid cohesion protein PDS5 homolog B

Protein Size: 1447

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58313_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58313_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23047
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×