PDS5B Antibody - middle region : HRP

PDS5B Antibody - middle region : HRP
Artikelnummer
AVIARP58313_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PDS5B plays a role in androgen-induced proliferative arrest in prostate cells. It is required for maintenance of sister chromatid cohesion during mitosis. Defects in PDS5B may be the cause of some cancers including esophageal cancer.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDS5B

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 159kDa

Peptide Sequence: Synthetic peptide located within the following region: DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Sister chromatid cohesion protein PDS5 homolog B

Protein Size: 1447

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58313_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58313_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23047
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×