PDXK Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: PDXK phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. PDXK is cytoplasmic and probably acts as a homodimer. The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDXK

Key Reference: Musayev,F.N., (2007) Protein Sci. 16 (10), 2184-2194

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: RKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pyridoxal kinase

Protein Size: 312

Purification: Affinity Purified

• Artikelnummer: AVIARP53616_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53616_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 8566
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin