PELI1 Antibody - N-terminal region : Biotin

PELI1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57429_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PELI1 is an scaffold protein involved in the IL-1 signaling pathway via its interaction with the complex containing IRAK kinases and TRAF6. PELI1 is required for NF-kappa-B activation and IL-8 gene expression in response to IL-1.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PELI1

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: ESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: E3 ubiquitin-protein ligase pellino homolog 1

Protein Size: 418

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57429_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57429_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57162
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×