PENK Antibody - middle region : HRP

PENK Antibody - middle region : HRP
Artikelnummer
AVIARP56676_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress. PENK (114-133) and PENK (237-258) increase glutamate release in the stri

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PENK

Key Reference: Nikoshkov,A., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (2), 786-791

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Proenkephalin-A

Protein Size: 267

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56676_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56676_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5179
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×