Pepd Antibody - middle region : Biotin

Pepd Antibody - middle region : Biotin
Artikelnummer
AVIARP56087_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Pepd splits dipeptides with a prolyl or hydroxyprolyl residue in the C-terminal position. It plays an important role in collagen metabolism because of the high level of iminoacids in collagen.

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: YSRGGMRHTSYTCICCSGENAAVLHYGHAGAPNDRTIKDGDICLFDMGGE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Xaa-Pro dipeptidase

Protein Size: 493

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56087_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56087_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 18624
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×