Pepd Antibody - middle region : HRP

Pepd Antibody - middle region : HRP
Artikelnummer
AVIARP56087_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Pepd splits dipeptides with a prolyl or hydroxyprolyl residue in the C-terminal position. It plays an important role in collagen metabolism because of the high level of iminoacids in collagen.

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: YSRGGMRHTSYTCICCSGENAAVLHYGHAGAPNDRTIKDGDICLFDMGGE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Xaa-Pro dipeptidase

Protein Size: 493

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56087_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56087_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 18624
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×