PEX26 Antibody - middle region : Biotin

PEX26 Antibody - middle region : Biotin
Artikelnummer
AVIARP57068_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene belongs to the peroxin-26 gene family. It is probably required for protein import into peroxisomes. It anchors PEX1 and PEX6 to peroxisome membranes, possibly to form heteromeric AAA ATPase complexes required for the import of proteins into pero

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PEX26

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: ELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peroxisome assembly protein 26

Protein Size: 305

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57068_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57068_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55670
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×