PEX7 Antibody - N-terminal region : HRP

PEX7 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56091_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PEX7 binds to the N-terminal PTS2-type peroxisomal targeting signal and plays an essential role in peroxisomal protein import.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PEX7

Key Reference: Arning,L., (er) J. Mol. Med. (2008) In press

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Peroxisomal targeting signal 2 receptor

Protein Size: 323

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56091_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56091_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5191
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×