Pfkfb2 Antibody - C-terminal region : FITC

Pfkfb2 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP56677_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: EMTYSEIEQRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 6-phosphofructo-2-kinase Ensembl ENSMUSP00000133073 Ensembl ENSMUSP00000066426

Protein Size: 518

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56677_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56677_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 18640
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×