PFKFB3 Antibody - C-terminal region : FITC

PFKFB3 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP56582_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene belongs to a family of bifunctional proteins that are involved in both the synthesis and degradation of fructose-2,6-bisphosphate, a regulatory molecule that controls glycolysis in eukaryotes. The encoded protein has a 6-phosphofructo-2-kinase activity that catalyzes the synthesis of fructose-2,6-bisphosphate (F2,6BP), and a fructose-2,6-biphosphatase activity that catalyzes the degradation of F2,6BP. This protein is required for cell cycle progression and prevention of apoptosis. It functions as a regulator of cyclin-dependent kinase 1, linking glucose metabolism to cell proliferation and survival in tumor cells. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human F263

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: VESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVAS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3

Protein Size: 520

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56582_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56582_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5209
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×